| structure name | CRYSTAL STRUCTURE OF LAGLIDADG MEGANUCLEASE I-GPEMI BOUND TO UNCLEAVED DNA (Ribosomal protein 3homing endonuclease-like fusion protein) |
| reference | Hallinan et al. Structure 24 862 2016 |
| source | Grosmannia penicillata |
| experiment | X-ray (resolution=2.15, R-factor=0.181) |
| structural superfamily | Homing endonucleases; |
| sequence family | LAGLIDADG endonuclease; |
| links to other resources | NAKB PDIdb DNAproDB |
| protein sequence | |
| interface signature | SRRNKSSEQTSASKCFSISSQQTYKKKFWET |
Estimated binding specificities ?
| readout + contact | ![]() |
A | 96 96 96 0 0 0 1 0 0 96 24 0 51 18 0 64 0 0 68 C | 0 0 0 0 0 0 9 0 0 0 24 0 18 1 0 32 0 0 11 G | 0 0 0 96 96 96 64 0 96 0 24 0 9 77 96 0 96 96 4 T | 0 0 0 0 0 0 22 96 0 0 24 96 18 0 0 0 0 0 13scan! |
Dendrogram of similar interfaces ?
matrix formathome
updated Sat Jan 10 07:38:42 2026


