4yhx_A : 3D-footprint complex

structure name	CRYSTAL STRUCTURE OF LAGLIDADG MEGANUCLEASE I-GPEMI BOUND TO UNCLEAVED DNA (Ribosomal protein 3homing endonuclease-like fusion protein)
reference	Hallinan et al. Structure 24 862 2016
source	Grosmannia penicillata
experiment	X-ray (resolution=2.15, R-factor=0.181)
structural superfamily	Homing endonucleases;
sequence family	LAGLIDADG endonuclease;
links to other resources	NAKB PDIdb DNAproDB
protein sequence	> 4yhx_A interface=18,22,24,26,28,29,34,36,40,42,66,70,72,74,172,174,176,178,180,182,187,189,195,215,217,219,221,224,226,228,232, nesinpwvltgfadaegSfilRiRnNnKSsagyStElgfQiTlhkkdksileniqstwkvgvianSgdnAvSlKvtrfedlrvvlnhfekyplitqklgdyllfkqafsvmenkehlkiegikrlvgikanlnwgltdelkeafvasggenifnknipnsgwlagftsgegCfFvSlIkSkSklgvQvQlvfsiTqhardrelmdnlvtylgcgYiKeKkKseFsWlEfvvTkfsdikdkiipvfqenniigvkledfedwckvaklieekkhltesgleeirniklnmnkgrv
interface signature	SRRNKSSEQTSASKCFSISSQQTYKKKFWET

Estimated binding specificities ?

readout + contact

# IC=20.116 IC/col=1.059 n_of_columns=19

specificity:

A |  96  96  96   0   0   0   0   0   0  96  24   0  47  18   0  64   0   0  68
C |   0   0   0   0   0   0   9   0   0   0  24   0   4   0   0  32   0   0   9
G |   0   0   0  96  96  96  27   0  96   0  24   0  27  78  96   0  96  96   4
T |   0   0   0   0   0   0  60  96   0   0  24  96  18   0   0   0   0   0  15

scan!

Dendrogram of similar interfaces ?

matrix format

home
updated Mon Jun 29 19:00:57 2026