structure name | CRYSTAL STRUCTURE OF LAGLIDADG MEGANUCLEASE I-GPEMI BOUND TO UNCLEAVED DNA (Ribosomal protein 3homing endonuclease-like fusion protein) |
reference | Hallinan et al. Structure 24 862 2016 |
source | Grosmannia penicillata |
experiment | X-ray (resolution=2.15, R-factor=0.181) |
structural superfamily | Homing endonucleases; |
sequence family | LAGLIDADG endonuclease; |
links to other resources | NAKB PDIdb DNAproDB |
protein sequence | |
interface signature | SRRNKSSEQTSASKCFSISSQQTYKKKFWET |
Estimated binding specificities ?
readout + contact |
A | 4 7 24 1 0 0 0 0 0 9 96 24 0 0 96 75 0 0 0 0 0 1 C | 7 21 24 3 96 96 0 96 78 12 0 24 0 96 0 21 96 96 96 0 0 5 G | 5 11 24 8 0 0 50 0 0 24 0 24 0 0 0 0 0 0 0 0 0 0 T | 80 57 24 84 0 0 46 0 18 51 0 24 96 0 0 0 0 0 0 96 96 90scan! |
Dendrogram of similar interfaces ?
matrix formathome
updated Fri Sep 13 19:03:00 2024