4yhx_A : 3D-footprint complex

structure name	CRYSTAL STRUCTURE OF LAGLIDADG MEGANUCLEASE I-GPEMI BOUND TO UNCLEAVED DNA (Ribosomal protein 3homing endonuclease-like fusion protein)
reference	Hallinan et al. Structure 24 862 2016
source	Grosmannia penicillata
experiment	X-ray (resolution=2.15, R-factor=0.181)
structural superfamily	Homing endonucleases;
sequence family	LAGLIDADG endonuclease;
links to other resources	NAKB PDIdb DNAproDB
protein sequence	> 4yhx_A interface=18,22,24,26,28,29,34,36,40,42,66,70,72,74,172,174,176,178,180,182,187,189,195,215,217,219,221,224,226,228,232, nesinpwvltgfadaegSfilRiRnNnKSsagyStElgfQiTlhkkdksileniqstwkvgvianSgdnAvSlKvtrfedlrvvlnhfekyplitqklgdyllfkqafsvmenkehlkiegikrlvgikanlnwgltdelkeafvasggenifnknipnsgwlagftsgegCfFvSlIkSkSklgvQvQlvfsiTqhardrelmdnlvtylgcgYiKeKkKseFsWlEfvvTkfsdikdkiipvfqenniigvkledfedwckvaklieekkhltesgleeirniklnmnkgrv
interface signature	SRRNKSSEQTSASKCFSISSQQTYKKKFWET

Estimated binding specificities ?

readout + contact

# IC=21.589 IC/col=0.981 n_of_columns=22

specificity:

A |   6  10  24   2   0   0   0   0   0  14  96  24   0   0  96  72   0   0   0   0   0   0
C |  14  10  24   4  96  96   0  96  86   8   0  24   0  96   0  22  96  96  94   0   0   4
G |   8  18  24   4   0   0  68   0   0  12   0  24   0   0   0   2   0   0   0   0   0   0
T |  68  58  24  86   0   0  28   0  10  62   0  24  96   0   0   0   0   0   2  96  96  92

scan!

Dendrogram of similar interfaces ?

matrix format

home
updated Sun Aug 3 08:42:42 2025