| structure name | I-ONUI K227Y, D236A BOUND TO COGNATE SUBSTRATE (PRE-CLEAVAGE COMPLEX) (Ribosomal protein 3homing endonuclease-like protein fusion) |
| reference | McMurrough et al. 'To ? ? ? |
| source | Ophiostoma novo-ulmi subsp. americana |
| experiment | X-ray (resolution=1.45, R-factor=0.166) |
| structural superfamily | Homing endonucleases; |
| sequence family | LAGLIDADG endonuclease; |
| redundant complexes | 3qqy_A
6bdb_A
|
| links to other resources | NAKB PDIdb DNAproDB |
| protein sequence | |
| interface signature | SRRNKSSEQTSASKCFNISKQQSTYKYKFWTK |
Estimated binding specificities ?
readout + contact | ![]() |
A | 13 24 0 0 0 96 0 0 13 24 24 0 0 96 96 0 0 0 0 0 0 C | 16 24 0 96 96 0 96 0 13 24 24 0 96 0 0 96 96 0 0 0 0 G | 13 24 0 0 0 0 0 0 13 24 24 0 0 0 0 0 0 0 0 0 0 T | 54 24 96 0 0 0 0 96 57 24 24 96 0 0 0 0 0 96 96 96 96scan! |
Dendrogram of similar interfaces ?
matrix formathome
updated Sat Jan 10 09:46:06 2026



+ 