| structure name | I-ONUI K227Y, D236A BOUND TO A3G SUBSTRATE (PRE-CLEAVAGE COMPLEX) (Ribosomal protein 3homing endonuclease-like protein fusion) |
| reference | McMurrough et al. 'To ? ? ? |
| source | Ophiostoma novo-ulmi subsp. americana |
| experiment | X-ray (resolution=1.50, R-factor=0.186) |
| structural superfamily | Homing endonucleases; |
| sequence family | LAGLIDADG endonuclease; |
| reference complex | 6bd0_A |
| links to other resources | NAKB PDIdb DNAproDB |
| protein sequence | |
| interface signature | SRRNKSEQTSASKCFNIQQSTYKYKEFWTK |
Estimated binding specificities ?
| readout + contact | ![]() |
A | 13 0 0 0 0 96 0 0 82 96 24 0 1 5 69 0 0 0 0 0 0 C | 8 0 5 96 96 0 96 8 4 0 24 8 91 0 6 96 75 0 0 0 0 G | 10 0 0 0 0 0 0 0 4 0 24 14 0 91 21 0 0 0 0 0 0 T | 65 96 91 0 0 0 0 88 6 0 24 74 4 0 0 0 21 96 96 96 96scan! |
home
updated Fri Jan 9 05:34:20 2026


