| structure name | CAMA ADENINE METHYLTRANSFERASE COMPLEXED TO COGNATE SUBSTRATE DNA AND INHIBITOR APNEA (COMPOUND 9) (Site-specific DNA-methyltransferase adenine-specific) |
| reference | Horton et al. J.Med.Chem. 66 934 2023 |
| source | Clostridioides difficile |
| experiment | X-ray (resolution=2.81, R-factor=0.172) |
| structural superfamily | S-adenosyl-L-methionine-dependent methyltransferases; |
| sequence family | N6 DNA Methylase 1743; |
| multimeric complexes | 8cxs_AB 8cxt_AB 8cxu_AB 8cxv_AB 8cxw_AB 8cxx_AB 8cxy_AB 8cxz_AB 8cy0_AB 8cy1_AB 8cy2_AB 8cy3_AB 8cy4_AB 8cy5_AB 8fs1_AB 8fs2_AB |
| reference complex | 8cxy_C |
| links to other resources | NAKB PDIdb DNAproDB |
| protein sequence | |
| interface signature | YNYHKDKYFIVQISREIQWRYKSADYMSIY |
Estimated binding specificities ?
| contact | ![]() |
A | 16 0 0 0 0 0 0 88 C | 45 0 0 0 0 0 0 2 G | 16 0 0 0 0 0 96 4 T | 19 96 96 96 96 96 0 2scan! |
home
updated Mon Jun 29 06:33:10 2026


